OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Calbindin (CALB1) (NM_004929) Human Mass Spec Standard

Be the first to review this product
SKU
PH301358
CALB1 MS Standard C13 and N15-labeled recombinant protein (NP_004920)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342845 Rabbit Polyclonal Anti-CALB1 Antibody
100 ul
$585.00
LY417646 Transient overexpression lysate of calbindin 1, 28kDa (CALB1) (as WB positive control) 100 ug
$436.00

Other products for "Calbindin or NM_004929"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201358
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC201358 protein sequence
Red=Cloning site Green=Tags(s)

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD
GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD
TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE
LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004920
RefSeq Size 2531
RefSeq ORF 783
Synonyms CALB; D-28K
Locus ID 793
UniProt ID P05937
Cytogenetics 8q21.3
Summary The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. provided by RefSeq, Jan 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Calbindin" proteins (3)
SKU Description Size Price
LC417646 Lyophilized CALB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417646 Transient overexpression lysate of calbindin 1, 28kDa (CALB1) (as WB positive control) 100 ug
$436.00
TP301358 Recombinant protein of human calbindin 1, 28kDa (CALB1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products