OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Calbindin (CALB1) (NM_004929) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201358
CALB1 (Myc-DDK-tagged)-Human calbindin 1, 28kDa (CALB1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349732 Rabbit Polyclonal Anti-CALB1 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Calbindin or NM_004929"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Calbindin
Synonyms CALB; D-28K
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201358 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAATCCCACCTGCAGTCATCCCTCATCACAGCCTCACAGTTTTTCGAGATCTGGCTCCATTTCG
ACGCTGACGGAAGTGGTTACCTGGAAGGAAAGGAGCTGCAGAACTTGATCCAGGAGCTCCAGCAGGCGCG
AAAGAAGGCTGGATTGGAGTTATCACCTGAAATGAAAACTTTTGTGGATCAGTATGGGCAAAGAGATGAT
GGAAAAATAGGAATTGTAGAGTTGGCTCACGTATTACCCACAGAAGAGAATTTCCTGCTGCTCTTCCGAT
GCCAGCAGCTGAAGTCCTGTGAGGAATTCATGAAGACATGGAGAAAATATGATACTGACCACAGTGGCTT
CATAGAAACTGAGGAGCTTAAGAACTTTCTAAAGGACCTGCTAGAAAAAGCAAACAAGACTGTTGATGAC
ACAAAATTAGCCGAGTATACAGACCTAATGCTGAAACTATTTGATTCAAATAATGATGGGAAGCTGGAAT
TAACTGAGATGGCCAGGTTACTACCAGTGCAGGAGAATTTTCTTCTTAAATTCCAGGGAATCAAAATGTG
TGGGAAAGAGTTCAATAAGGCTTTTGAGCTGTATGATCAGGACGGCAATGGATACATAGATGAAAATGAA
CTGGATGCTTTACTGAAGGATCTGTGCGAGAAGAATAAACAGGATCTGGATATTAATAATATTACAACAT
ACAAGAAGAACATAATGGCTTTGTCGGATGGAGGGAAGCTGTACCGAACGGATCTTGCTCTTATTCTCTG
TGCTGGGGATAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201358 protein sequence
Red=Cloning site Green=Tags(s)

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD
GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD
TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE
LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004929
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004929.4
RefSeq Size 2531 bp
RefSeq ORF 786 bp
Locus ID 793
UniProt ID P05937
Cytogenetics 8q21.3
Domains EFh
MW 30 kDa
Summary The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. provided by RefSeq, Jan 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004929" in other vectors (6)
SKU Description Size Price
RC201358L1 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), Myc-DDK-tagged 10 ug
$600.00
RC201358L2 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), mGFP tagged 10 ug
$600.00
RC201358L3 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), Myc-DDK-tagged 10 ug
$600.00
RC201358L4 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), mGFP tagged 10 ug
$600.00
RG201358 CALB1 (tGFP-tagged) - Human calbindin 1, 28kDa (CALB1) 10 ug
$489.00 $500.00
SC117035 CALB1 (untagged)-Human calbindin 1, 28kDa (CALB1) 10 ug
$300.00

Plasmid Map for RC201358

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201358
Circular map for RC201358

file-alt Citations

Multiplexed volumetric CLEM enabled by scFvs provides insights into the cytology of cerebellar cortex
Han, Lu, Li et al
Nat Commun (2024) 15 (1), 6648 DOI: 10.1038/s41467-024-50411-z
Cited by 9
AI Summary: In this study, OriGene's Flag-tagged human calbindin plasmid (OriGene #RC201358) was used to transfect cells, enabling the generation and validation of fluorescent probes for multiplexed immunolabeling in correlated light and electron microscopy of the cerebellar cortex.
Snippet: rslip bottom 3.5-mm dishes (ibidi #81218-200). After adherence, cells were transfected with mammalian expression plasmids encoding mEmerald-tagged GFAP (Addgene #54107 or Flag-tagged human calbindin (Origene # RC201358) using Lipofectamine 2000 (Thermo Fisher # 11668500) or Lipofectamine 3000 (Thermo Fisher # L3000001) transfection reagent following the manufacturer’s protocol. Cells were used 4
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products