Calbindin (CALB1) (NM_004929) Human Tagged ORF Clone

SKU
RC201358
CALB1 (Myc-DDK-tagged)-Human calbindin 1, 28kDa (CALB1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Calbindin
Synonyms CALB; D-28K
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201358 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAATCCCACCTGCAGTCATCCCTCATCACAGCCTCACAGTTTTTCGAGATCTGGCTCCATTTCG
ACGCTGACGGAAGTGGTTACCTGGAAGGAAAGGAGCTGCAGAACTTGATCCAGGAGCTCCAGCAGGCGCG
AAAGAAGGCTGGATTGGAGTTATCACCTGAAATGAAAACTTTTGTGGATCAGTATGGGCAAAGAGATGAT
GGAAAAATAGGAATTGTAGAGTTGGCTCACGTATTACCCACAGAAGAGAATTTCCTGCTGCTCTTCCGAT
GCCAGCAGCTGAAGTCCTGTGAGGAATTCATGAAGACATGGAGAAAATATGATACTGACCACAGTGGCTT
CATAGAAACTGAGGAGCTTAAGAACTTTCTAAAGGACCTGCTAGAAAAAGCAAACAAGACTGTTGATGAC
ACAAAATTAGCCGAGTATACAGACCTAATGCTGAAACTATTTGATTCAAATAATGATGGGAAGCTGGAAT
TAACTGAGATGGCCAGGTTACTACCAGTGCAGGAGAATTTTCTTCTTAAATTCCAGGGAATCAAAATGTG
TGGGAAAGAGTTCAATAAGGCTTTTGAGCTGTATGATCAGGACGGCAATGGATACATAGATGAAAATGAA
CTGGATGCTTTACTGAAGGATCTGTGCGAGAAGAATAAACAGGATCTGGATATTAATAATATTACAACAT
ACAAGAAGAACATAATGGCTTTGTCGGATGGAGGGAAGCTGTACCGAACGGATCTTGCTCTTATTCTCTG
TGCTGGGGATAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201358 protein sequence
Red=Cloning site Green=Tags(s)

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD
GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD
TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE
LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004929
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004929.4
RefSeq Size 2531 bp
RefSeq ORF 786 bp
Locus ID 793
UniProt ID P05937
Cytogenetics 8q21.3
Domains EFh
MW 30 kDa
Summary The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. [provided by RefSeq, Jan 2015]
Write Your Own Review
You're reviewing:Calbindin (CALB1) (NM_004929) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201358L1 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), Myc-DDK-tagged 10 ug
$600.00
RC201358L2 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), mGFP tagged 10 ug
$600.00
RC201358L3 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), Myc-DDK-tagged 10 ug
$600.00
RC201358L4 Lenti ORF clone of Human calbindin 1, 28kDa (CALB1), mGFP tagged 10 ug
$600.00
RG201358 CALB1 (tGFP-tagged) - Human calbindin 1, 28kDa (CALB1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117035 CALB1 (untagged)-Human calbindin 1, 28kDa (CALB1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.