OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ISCA1 (NM_030940) Human Mass Spec Standard

Be the first to review this product
SKU
PH301335
ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410656 Transient overexpression lysate of iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1) (as WB positive control) 100 ug
$436.00

Other products for "ISCA1 or NM_030940"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201335
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC201335 protein sequence
Red=Cloning site Green=Tags(s)

MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK
GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112202
RefSeq Size 2012
RefSeq ORF 387
Synonyms HBLD2; hIscA; ISA1; MMDS5
Locus ID 81689
UniProt ID Q9BUE6
Cytogenetics 9q21.33
Summary ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 PubMed 15262227).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ISCA1" proteins (3)
SKU Description Size Price
LC410656 Lyophilized ISCA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410656 Transient overexpression lysate of iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1) (as WB positive control) 100 ug
$436.00
TP301335 Recombinant protein of human iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products