OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

M6PR (NM_002355) Human Mass Spec Standard

Be the first to review this product
SKU
PH301277
M6PR MS Standard C13 and N15-labeled recombinant protein (NP_002346)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812721 M6PR mouse monoclonal antibody,clone OTI2F3 100 ul
$447.00
LY419372 Transient overexpression lysate of mannose-6-phosphate receptor (cation dependent) (M6PR) (as WB positive control) 100 ug
$436.00

Other products for "M6PR or NM_002355"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201277
Predicted MW 31 kDa
Protein Sequence
Protein Sequence
>RC201277 protein sequence
Red=Cloning site Green=Tags(s)

MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT
YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV
VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY
QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002346
RefSeq Size 2583
RefSeq ORF 831
Synonyms CD-M6PR; CD-MPR; MPR-46; MPR 46; MPR46; SMPR
Locus ID 4074
UniProt ID P20645
Cytogenetics 12p13.31
Summary This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. provided by RefSeq, May 2011
Protein Families Druggable Genome, Transmembrane
Protein Pathways Lysosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "M6PR" proteins (3)
SKU Description Size Price
LC419372 Lyophilized M6PR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419372 Transient overexpression lysate of mannose-6-phosphate receptor (cation dependent) (M6PR) (as WB positive control) 100 ug
$436.00
TP301277 Recombinant protein of human mannose-6-phosphate receptor (cation dependent) (M6PR), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products