OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAP1 (DAP) (NM_004394) Human Mass Spec Standard

Be the first to review this product
SKU
PH301120
DAP MS Standard C13 and N15-labeled recombinant protein (NP_004385)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351124 Rabbit Polyclonal Anti-DAP Antibody
100 ul
$205.00
LY418020 Transient overexpression lysate of death-associated protein (DAP) (as WB positive control) 100 ug
$436.00

Other products for "DAP1 or NM_004394"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201120
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC201120 protein sequence
Red=Cloning site Green=Tags(s)

MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDF
PPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004385
RefSeq Size 2385
RefSeq ORF 306
Locus ID 1611
UniProt ID P51397
Cytogenetics 5p15.2
Summary This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, May 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DAP1" proteins (3)
SKU Description Size Price
LC418020 Lyophilized DAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418020 Transient overexpression lysate of death-associated protein (DAP) (as WB positive control) 100 ug
$436.00
TP301120 Recombinant protein of human death-associated protein (DAP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products