OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TOMM34 (NM_006809) Human Mass Spec Standard

Be the first to review this product
SKU
PH301083
TOMM34 MS Standard C13 and N15-labeled recombinant protein (NP_006800)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503090 TOMM34 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9) 100 ul
$447.00
LY416405 Transient overexpression lysate of translocase of outer mitochondrial membrane 34 (TOMM34), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "TOMM34 or NM_006809"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201083
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC201083 protein sequence
Red=Cloning site Green=Tags(s)

MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDC
IKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEW
RLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHK
KAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSS
FADISNLLQIEPRNGPAQKLRQEVKQNLH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006800
RefSeq Size 2066
RefSeq ORF 927
Synonyms HTOM34P; TOM34; URCC3
Locus ID 10953
UniProt ID Q15785
Cytogenetics 20q13.12
Summary The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TOMM34" proteins (3)
SKU Description Size Price
LC416405 Lyophilized TOMM34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416405 Transient overexpression lysate of translocase of outer mitochondrial membrane 34 (TOMM34), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP301083 Recombinant protein of human translocase of outer mitochondrial membrane 34 (TOMM34), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products