CBR3 (NM_001236) Human Mass Spec Standard

CAT#: PH301073

CBR3 MS Standard C13 and N15-labeled recombinant protein (NP_001227)

Product Images

Coomassie blue staining of purified CBR3 protein (Cat# TP301073). The protein was produced from HEK293T cells transfected with CBR3 cDNA clone (Cat# RC201073) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201073
• Predicted MW: 30.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201073 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI
  RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS
  LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR
  RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001227
• RefSeq Size: 1128
• RefSeq ORF: 831
• Synonyms: hCBR3; HEL-S-25; SDR21C2
• Locus ID: 874
• UniProt ID: O75828, V9HW40
• Cytogenetics: 21q22.12
• Summary: Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways