OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CEP55 (NM_018131) Human Mass Spec Standard

Be the first to review this product
SKU
PH301052
CEP55 MS Standard C13 and N15-labeled recombinant protein (NP_060601)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808973 CEP55 mouse monoclonal antibody,clone OTI10C4 100 ul
$447.00
LY413284 Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CEP55 or NM_018131"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201052
Predicted MW 54.1 kDa
Protein Sequence
Protein Sequence
>RC201052 protein sequence
Red=Cloning site Green=Tags(s)

MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK
EKNAYQLTEKDKEIQRLRDQLKARYSTTALLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA
ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE
TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN
QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA
LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060601
RefSeq Size 2656
RefSeq ORF 1392
Synonyms C10orf3; CT111; MARCH; URCC6
Locus ID 55165
UniProt ID Q53EZ4
Cytogenetics 10q23.33
Summary Plays a role in mitotic exit and cytokinesis (PubMed:16198290, PubMed:17853893). Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis (PubMed:17853893). Not required for microtubule nucleation (PubMed:16198290). Plays a role in the development of the brain and kidney (PubMed:28264986).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CEP55" proteins (6)
SKU Description Size Price
LC413284 Lyophilized CEP55 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426692 Lyophilized CEP55 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413284 Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426692 Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301052 Recombinant protein of human centrosomal protein 55kDa (CEP55), transcript variant 1, 20 µg 20 ug
$867.00
TP761544 Purified recombinant protein of Human centrosomal protein 55kDa (CEP55), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products