OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF181 (NM_016494) Human Mass Spec Standard

Be the first to review this product
SKU
PH301048
RNF181 MS Standard C13 and N15-labeled recombinant protein (NP_057578)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380989 RNF181 Rabbit polyclonal Antibody
100 ul
$410.00
LY413935 Transient overexpression lysate of ring finger protein 181 (RNF181) (as WB positive control) 100 ug
$436.00

Other products for "RNF181 or NM_016494"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201048
Predicted MW 17.9 kDa
Protein Sequence
Protein Sequence
>RC201048 protein sequence
Red=Cloning site Green=Tags(s)

MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGS
QAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQ
QHRLENLHGAMYT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057578
RefSeq Size 716
RefSeq ORF 459
Synonyms HSPC238
Locus ID 51255
UniProt ID Q9P0P0
Cytogenetics 2p11.2
Summary RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 PubMed 18331836).supplied by OMIM, Dec 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF181" proteins (3)
SKU Description Size Price
LC413935 Lyophilized RNF181 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413935 Transient overexpression lysate of ring finger protein 181 (RNF181) (as WB positive control) 100 ug
$436.00
TP301048 Recombinant protein of human ring finger protein 181 (RNF181), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products