OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C11ORF67 (AAMDC) (NM_024684) Human Mass Spec Standard

Be the first to review this product
SKU
PH301033
C11orf67 MS Standard C13 and N15-labeled recombinant protein (NP_078960)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411144 Transient overexpression lysate of chromosome 11 open reading frame 67 (C11orf67) (as WB positive control) 100 ug
$436.00

Other products for "C11ORF67 or NM_024684"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201033
Predicted MW 13.3 kDa
Protein Sequence
Protein Sequence
>RC201033 protein sequence
Red=Cloning site Green=Tags(s)

MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRG
MSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078960
RefSeq Size 557
RefSeq ORF 366
Synonyms C11orf67; CK067; PTD015
Locus ID 28971
UniProt ID Q9H7C9
Cytogenetics 11q14.1
Summary May play a role in preadipocyte differentiation and adipogenesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C11ORF67" proteins (3)
SKU Description Size Price
LC411144 Lyophilized AAMDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411144 Transient overexpression lysate of chromosome 11 open reading frame 67 (C11orf67) (as WB positive control) 100 ug
$436.00
TP301033 Recombinant protein of human chromosome 11 open reading frame 67 (C11orf67), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products