C11ORF67 (AAMDC) (NM_024684) Human Recombinant Protein

SKU TP301033

Recombinant protein of human chromosome 11 open reading frame 67 (C11orf67), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201033 protein sequence; Red=Cloning site Green=Tags(s); ; MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRG; MSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_078960
• Locus ID: 28971
• UniProt ID: Q9H7C9
• Cytogenetics: 11q14.1
• RefSeq Size: 557
• RefSeq ORF: 366
• Synonyms: C11orf67; CK067; PTD015
• Summary: May play a role in preadipocyte differentiation and adipogenesis.[UniProtKB/Swiss-Prot Function]