OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

H2AW (NM_033445) Human Mass Spec Standard

Be the first to review this product
SKU
PH300984
HIST3H2A MS Standard C13 and N15-labeled recombinant protein (NP_254280)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA347208 Rabbit Polyclonal H2AK5ac Antibody
50 ug
$645.00
LY409510 Transient overexpression lysate of histone cluster 3, H2a (HIST3H2A) (as WB positive control) 100 ug
$436.00

Other products for "H2AW or NM_033445"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200984
Predicted MW 13.9 kDa
Protein Sequence
Protein Sequence
>RC200984 representing NM_033445
Red=Cloning site Green=Tags(s)

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_254280
RefSeq Size 496
RefSeq ORF 390
Synonyms HIST3H2A
Locus ID 92815
UniProt ID Q7L7L0
Cytogenetics 1q42.13
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. provided by RefSeq, Aug 2015
Protein Pathways Systemic lupus erythematosus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "H2AW" proteins (4)
SKU Description Size Price
LC409510 Lyophilized HIST3H2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409510 Transient overexpression lysate of histone cluster 3, H2a (HIST3H2A) (as WB positive control) 100 ug
$436.00
TP300984 Recombinant protein of human histone cluster 3, H2a (HIST3H2A), 20 µg 20 ug
$867.00
TP710343 Purified recombinant protein of Human histone cluster 3, H2a (HIST3H2A), full length, with with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products