H2AW (NM_033445) Human Recombinant Protein
SKU
TP300984
Recombinant protein of human histone cluster 3, H2a (HIST3H2A), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200984 representing NM_033445
Red=Cloning site Green=Tags(s) MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_254280 |
Locus ID | 92815 |
UniProt ID | Q7L7L0 |
Cytogenetics | 1q42.13 |
RefSeq Size | 496 |
RefSeq ORF | 390 |
Synonyms | HIST3H2A |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300984 | HIST3H2A MS Standard C13 and N15-labeled recombinant protein (NP_254280) | 10 ug |
$3,255.00
|
|
LC409510 | HIST3H2A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409510 | Transient overexpression lysate of histone cluster 3, H2a (HIST3H2A) | 100 ug |
$436.00
|
|
TP710343 | Purified recombinant protein of Human histone cluster 3, H2a (HIST3H2A), full length, with with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.