OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SFXN3 (NM_030971) Human Mass Spec Standard

Be the first to review this product
SKU
PH300974
SFXN3 MS Standard C13 and N15-labeled recombinant protein (NP_112233)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339575 Rabbit Polyclonal Anti-SFXN3 Antibody
100 ul
$585.00
LY410634 Transient overexpression lysate of sideroflexin 3 (SFXN3) (as WB positive control) 100 ug
$436.00

Other products for "SFXN3 or NM_030971"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200974
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC200974 protein sequence
Red=Cloning site Green=Tags(s)

MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQ
LWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRS
GDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPV
ADEAGQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLV
FATPLCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112233
RefSeq Size 3129
RefSeq ORF 975
Synonyms BA108L7.2; SFX3; SLC56A3
Locus ID 81855
UniProt ID Q9BWM7
Cytogenetics 10q24.31
Summary Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (PubMed:30442778). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors (PubMed:30442778).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SFXN3" proteins (3)
SKU Description Size Price
LC410634 Lyophilized SFXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410634 Transient overexpression lysate of sideroflexin 3 (SFXN3) (as WB positive control) 100 ug
$436.00
TP300974 Recombinant protein of human sideroflexin 3 (SFXN3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products