SFXN3 (NM_030971) Human Mass Spec Standard

CAT#: PH300974

SFXN3 MS Standard C13 and N15-labeled recombinant protein (NP_112233)

Product Images

Coomassie blue staining of purified SFXN3 protein (Cat# TP300974). The protein was produced from HEK293T cells transfected with SFXN3 cDNA clone (Cat# RC200974) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200974
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC200974 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQ
  LWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRS
  GDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPV
  ADEAGQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLV
  FATPLCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112233
• RefSeq Size: 3129
• RefSeq ORF: 975
• Synonyms: BA108L7.2; SFX3; SLC56A3
• Locus ID: 81855
• UniProt ID: Q9BWM7, A0A1P0AYU5
• Cytogenetics: 10q24.31
• Summary: Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (PubMed:30442778). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors (PubMed:30442778).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane