OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DBNDD1 (NM_024043) Human Mass Spec Standard

Be the first to review this product
SKU
PH300971
DBNDD1 MS Standard C13 and N15-labeled recombinant protein (NP_076948)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411419 Transient overexpression lysate of dysbindin (dystrobrevin binding protein 1) domain containing 1 (DBNDD1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DBNDD1 or NM_024043"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200971
Predicted MW 19.6 kDa
Protein Sequence
Protein Sequence
>RC200971 protein sequence
Red=Cloning site Green=Tags(s)

MGETWKNICSTVRHGWWLRDHRMAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAP
GLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSP
SWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076948
RefSeq Size 2099
RefSeq ORF 534
Locus ID 79007
UniProt ID Q9H9R9
Cytogenetics 16q24.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DBNDD1" proteins (5)
SKU Description Size Price
LC411419 Lyophilized DBNDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421006 Lyophilized DBNDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411419 Transient overexpression lysate of dysbindin (dystrobrevin binding protein 1) domain containing 1 (DBNDD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421006 Transient overexpression lysate of dysbindin (dystrobrevin binding protein 1) domain containing 1 (DBNDD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300971 Recombinant protein of human dysbindin (dystrobrevin binding protein 1) domain containing 1 (DBNDD1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products