OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM51 (NM_018022) Human Mass Spec Standard

Be the first to review this product
SKU
PH300965
TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_060492)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342352 Rabbit Polyclonal Anti-TMEM51 Antibody
100 ul
$585.00
LY413385 Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "TMEM51 or NM_018022"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200965
Predicted MW 27.8 kDa
Protein Sequence
Protein Sequence
>RC200965 protein sequence
Red=Cloning site Green=Tags(s)

MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV
GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT
NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK
LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060492
RefSeq Size 1927
RefSeq ORF 759
Synonyms C1orf72
Locus ID 55092
UniProt ID Q9NW97
Cytogenetics 1p36.21
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM51" proteins (13)
SKU Description Size Price
PH326828 TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129689) 10 ug
$3,360.00
PH326856 TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129690) 10 ug
$3,360.00
LC413385 Lyophilized TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427856 Lyophilized TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427857 Lyophilized TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427858 Lyophilized TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413385 Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY427856 Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427857 Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427858 Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP300965 Recombinant protein of human transmembrane protein 51 (TMEM51), transcript variant 4, 20 µg 20 ug
$867.00
TP326828 Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 2, 20 µg 20 ug
$867.00
TP326856 Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products