OriGene Logo

TMEM51 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342352
Rabbit Polyclonal Anti-TMEM51 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY413385 Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 100 ug
$436.00
TP300965 Recombinant protein of human transmembrane protein 51 (TMEM51), transcript variant 4, 20 µg
20 ug
$867.00

View other "TMEM51 or NM_018022" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM51 antibody: synthetic peptide directed towards the N terminal of human TMEM51. Synthetic peptide located within the following region: GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name transmembrane protein 51
Database Link
Background TMEM51 is a multi-pass membrane protein. The function of the TMEM51 protein remains unknown.
Synonyms C1orf72
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 85%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.