OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAXX (NM_183241) Human Mass Spec Standard

Be the first to review this product
SKU
PH300944
C9orf142 MS Standard C13 and N15-labeled recombinant protein (NP_899064)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405236 Transient overexpression lysate of chromosome 9 open reading frame 142 (C9orf142) (as WB positive control) 100 ug
$436.00

Other products for "PAXX or NM_183241"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200944
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC200944 protein sequence
Red=Cloning site Green=Tags(s)

MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAE
DITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLA
AAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899064
RefSeq Size 851
RefSeq ORF 612
Synonyms C9orf142; XLS
Locus ID 286257
UniProt ID Q9BUH6
Cytogenetics 9q34.3
Summary The protein encoded by this gene plays a role in the nonhomologous end joining (NHEJ) pathway of DNA double-strand break repair. The encoded protein may function to stabilize the Ku70/Ku80 heterodimer to facilitate the assembly and maintain the stability of the NHEJ complex. provided by RefSeq, Jul 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAXX" proteins (3)
SKU Description Size Price
LC405236 Lyophilized C9orf142 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405236 Transient overexpression lysate of chromosome 9 open reading frame 142 (C9orf142) (as WB positive control) 100 ug
$436.00
TP300944 Recombinant protein of human chromosome 9 open reading frame 142 (C9orf142), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products