CCDC120 (NM_033626) Human Mass Spec Standard

SKU
PH300937
CCDC120 MS Standard C13 and N15-labeled recombinant protein (NP_296375)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200937]
Predicted MW 67.4 kDa
Protein Sequence
Protein Sequence
>RC200937 representing NM_033626
Red=Cloning site Green=Tags(s)

MEVKGQLISSPTFNAPAALFGEAAPQVKSERLRGLLDRQRTLQEALSLKLQELRKVCLQEAELTGQLPPE
CPLEPGERPQLVRRRPPTARAYPPPHPNQAHHSLCPAEELALEALEREVSVQQQIAAAARRLALAPDLST
EQRRRRRQVQADALRRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGMRLAQLSQEDVV
LHSESSSLSESGASHDNEEPHGCFSLAERPSPPKAWDQLRAVSGGSPERRTPWKPPPSDLYGDLKSRRNS
VASPTSPTRSLPRSASSFEGRSVPATPVLTRGAGPQLCKPEGLHSRQWSGSQDSQMGFPRADPASDRASL
FVARTRRSNSSEALLVDRAAGGGAGSPPAPLAPSASGPPVCKSSEVLYERPQPTPAFSSRTAGPPDPPRA
ARPSSAAPASRGAPRLPPVCGDFLLDYSLDRGLPRSGGGTGWGELPPAAEVPGPLSRRDGLLTMLPGPPP
VYAADSNSPLLRTKDPHTRATRTKPCGLPPEAAEGPEVHPNPLLWMPPPTRIPSAGERSGHKNLALEGLR
DWYIRNSGLAAGPQRRPVLPSVGPPHPPFLHARCYEVGQALYGAPSQAPLPHSRSFTAPPVSGRYGGCFY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_296375
RefSeq Size 4004
RefSeq ORF 1890
Synonyms JM11
Locus ID 90060
UniProt ID Q96HB5
Cytogenetics Xp11.23
Summary This gene encodes a protein that contains a coiled-coil domain. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Nov 2012]
Write Your Own Review
You're reviewing:CCDC120 (NM_033626) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409489 CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431547 CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431550 CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409489 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 3 100 ug
$436.00
LY431547 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 2 100 ug
$436.00
LY431550 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 1 100 ug
$436.00
TP300937 Recombinant protein of human coiled-coil domain containing 120 (CCDC120), 20 µg 20 ug
$867.00
TP328522 Recombinant protein of human coiled-coil domain containing 120 (CCDC120), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.