OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC120 (NM_033626) Human Mass Spec Standard

Be the first to review this product
SKU
PH300937
CCDC120 MS Standard C13 and N15-labeled recombinant protein (NP_296375)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369918 CCDC120 rabbit polyclonal antibody
100 ul
$310.00
LY409489 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "CCDC120 or NM_033626"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200937
Predicted MW 67.4 kDa
Protein Sequence
Protein Sequence
>RC200937 representing NM_033626
Red=Cloning site Green=Tags(s)

MEVKGQLISSPTFNAPAALFGEAAPQVKSERLRGLLDRQRTLQEALSLKLQELRKVCLQEAELTGQLPPE
CPLEPGERPQLVRRRPPTARAYPPPHPNQAHHSLCPAEELALEALEREVSVQQQIAAAARRLALAPDLST
EQRRRRRQVQADALRRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGMRLAQLSQEDVV
LHSESSSLSESGASHDNEEPHGCFSLAERPSPPKAWDQLRAVSGGSPERRTPWKPPPSDLYGDLKSRRNS
VASPTSPTRSLPRSASSFEGRSVPATPVLTRGAGPQLCKPEGLHSRQWSGSQDSQMGFPRADPASDRASL
FVARTRRSNSSEALLVDRAAGGGAGSPPAPLAPSASGPPVCKSSEVLYERPQPTPAFSSRTAGPPDPPRA
ARPSSAAPASRGAPRLPPVCGDFLLDYSLDRGLPRSGGGTGWGELPPAAEVPGPLSRRDGLLTMLPGPPP
VYAADSNSPLLRTKDPHTRATRTKPCGLPPEAAEGPEVHPNPLLWMPPPTRIPSAGERSGHKNLALEGLR
DWYIRNSGLAAGPQRRPVLPSVGPPHPPFLHARCYEVGQALYGAPSQAPLPHSRSFTAPPVSGRYGGCFY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_296375
RefSeq Size 4004
RefSeq ORF 1890
Synonyms JM11
Locus ID 90060
UniProt ID Q96HB5
Cytogenetics Xp11.23
Summary This gene encodes a protein that contains a coiled-coil domain. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. provided by RefSeq, Nov 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC120" proteins (8)
SKU Description Size Price
LC409489 Lyophilized CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431547 Lyophilized CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431550 Lyophilized CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409489 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431547 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431550 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300937 Recombinant protein of human coiled-coil domain containing 120 (CCDC120), 20 µg 20 ug
$867.00
TP328522 Recombinant protein of human coiled-coil domain containing 120 (CCDC120), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products