CCDC120 (NM_001163321) Human Recombinant Protein

SKU
TP328522
Recombinant protein of human coiled-coil domain containing 120 (CCDC120), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228522 representing NM_001163321
Red=Cloning site Green=Tags(s)

MEVKGQLISSPTFNAPAALFGEAAPQVKSERLRGLLDRQRTLQEALSLKLQELRKVCLQEAELTGQLPPE
CPLEPGERPQLVRRRPPTARAYPPPHPNQAHHSLCPAEELALEALEREVSVQQQIAAAARRLALAPDLST
EQRRRRRQVQADALRRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGMRLAQLSQEDVV
LHSESSSLSESGASHDNEEPHGCFSLAERPSPPKAWDQLRAVSGGSPERRTPWKPPPSDLYGDLKSRRNS
VASPTSPTRSLPRSASSFEGRSVPATPVLTRGAGPQLCKPEGLHSRQWSGSQDSQMGFPRADPASDRASL
FVARTRRSNSSEALLVDRAAGGGAGSPPAPLAPSASGPPVCKSSEVLYERPQPTPAFSSRTAGPPDPPRA
ARPSSAAPASRGAPRLPPVCGDFLLDYSLDRGLPRSGGGTGWGELPPAAEVPGPLSRRDGLLTMLPGPPP
VYAADSNSPLLRTKDPHTRATRTKPCGLPPEAAEGPEVHPNPLLWMPPPTRIPSAGERSGHKNLALEGLR
DWYIRNSGLAAGPQRRPVLPSVGPPHPPFLHARCYEVGQALYGAPSQAPLPHSRSFTAPPVSGRYYADFL
YPPELSARLSDLTLEGEQSSSSDTQTPGTLV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 70.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001156793
Locus ID 90060
UniProt ID Q96HB5
Cytogenetics Xp11.23
RefSeq ORF 1983
Synonyms JM11
Summary This gene encodes a protein that contains a coiled-coil domain. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Nov 2012]
Write Your Own Review
You're reviewing:CCDC120 (NM_001163321) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300937 CCDC120 MS Standard C13 and N15-labeled recombinant protein (NP_296375) 10 ug
$3,255.00
LC409489 CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431547 CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431550 CCDC120 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409489 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 3 100 ug
$436.00
LY431547 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 2 100 ug
$436.00
LY431550 Transient overexpression lysate of coiled-coil domain containing 120 (CCDC120), transcript variant 1 100 ug
$436.00
TP300937 Recombinant protein of human coiled-coil domain containing 120 (CCDC120), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.