OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRAS40 (AKT1S1) (NM_032375) Human Mass Spec Standard

Be the first to review this product
SKU
PH300919
AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373421 AKT1S1/PRAS40 Rabbit polyclonal Antibody
100 ul
$410.00
LY420655 Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PRAS40 or NM_032375"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200919
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC200919 representing NM_032375
Red=Cloning site Green=Tags(s)

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYPAHGRGALAEAARRCLHDIALAHR
AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL
PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP
SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115751
RefSeq Size 2344
RefSeq ORF 768
Synonyms Lobe; PRAS40
Locus ID 84335
UniProt ID Q96B36
Cytogenetics 19q13.33
Summary AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 PubMed 12524439).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRAS40" proteins (9)
SKU Description Size Price
PH311995 AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092102) 10 ug
$3,360.00
PH312216 AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) 10 ug
$3,360.00
LC410168 Lyophilized AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420655 Lyophilized AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410168 Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420655 Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300919 Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 20 µg 20 ug
$737.00
TP311995 Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2, 20 µg 20 ug
$737.00
TP312216 Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products