PRAS40 (AKT1S1) (NM_001098632) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC211995] |
Predicted MW | 27.2 kDa |
Protein Sequence |
Protein Sequence
>RC211995 representing NM_001098632
Red=Cloning site Green=Tags(s) MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001092102 |
RefSeq Size | 2033 |
RefSeq ORF | 768 |
Synonyms | Lobe; PRAS40 |
Locus ID | 84335 |
UniProt ID | Q96B36 |
Cytogenetics | 19q13.33 |
Summary | AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300919 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751) | 10 ug |
$3,255.00
|
|
PH312216 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) | 10 ug |
$3,255.00
|
|
LC410168 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420655 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410168 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 | 100 ug |
$436.00
|
|
LY420655 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 | 100 ug |
$436.00
|
|
TP300919 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP311995 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP312216 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.