PRAS40 (AKT1S1) (NM_001098632) Human Mass Spec Standard

SKU
PH311995
AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092102)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211995]
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC211995 representing NM_001098632
Red=Cloning site Green=Tags(s)

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR
AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL
PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP
SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092102
RefSeq Size 2033
RefSeq ORF 768
Synonyms Lobe; PRAS40
Locus ID 84335
UniProt ID Q96B36
Cytogenetics 19q13.33
Summary AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:PRAS40 (AKT1S1) (NM_001098632) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300919 AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751) 10 ug
$3,255.00
PH312216 AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) 10 ug
$3,255.00
LC410168 AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420655 AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410168 Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 100 ug
$436.00
LY420655 Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 100 ug
$436.00
TP300919 Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 20 µg 20 ug
$737.00
TP311995 Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2, 20 µg 20 ug
$737.00
TP312216 Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.