robld3 (LAMTOR2) (NM_014017) Human Mass Spec Standard

CAT#: PH300862

ROBLD3 MS Standard C13 and N15-labeled recombinant protein (NP_054736)

Product Images

Coomassie blue staining of purified LAMTOR2 protein (Cat# TP300862). The protein was produced from HEK293T cells transfected with LAMTOR2 cDNA clone (Cat# RC200862) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200862
• Predicted MW: 13.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200862 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLK
  FILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054736
• RefSeq Size: 699
• RefSeq ORF: 375
• Synonyms: ENDAP; HSPC003; MAPBPIP; MAPKSP1AP; p14; Ragulator2; ROBLD3
• Locus ID: 28956
• UniProt ID: Q9Y2Q5
• Cytogenetics: 1q22
• Summary: The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]