OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HAGHL (NM_032304) Human Mass Spec Standard

Be the first to review this product
SKU
PH300832
HAGHL MS Standard C13 and N15-labeled recombinant protein (NP_115680)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502537 HAGHL mouse monoclonal antibody, clone OTI3H2 (formerly 3H2) 100 ul
$447.00
LY404116 Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HAGHL or NM_032304"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200832
Predicted MW 31.2 kDa
Protein Sequence
Protein Sequence
>RC200832 protein sequence
Red=Cloning site Green=Tags(s)

MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR
PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG
CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTV
PSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAP
HD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115680
RefSeq Size 1386
RefSeq ORF 846
Locus ID 84264
UniProt ID Q6PII5
Cytogenetics 16p13.3
Summary Hydrolase acting on ester bonds.UniProtKB/Swiss-Prot Function
Protein Pathways Pyruvate metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HAGHL" proteins (6)
SKU Description Size Price
LC404116 Lyophilized HAGHL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410246 Lyophilized HAGHL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404116 Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY410246 Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300832 Recombinant protein of human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2, 20 µg 20 ug
$737.00
TP761798 Purified recombinant protein of Human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products