OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDCA3 (NM_031299) Human Mass Spec Standard

Be the first to review this product
SKU
PH300821
CDCA3 MS Standard C13 and N15-labeled recombinant protein (NP_112589)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811694 CDCA3 mouse monoclonal antibody,clone OTI6F7 100 ul
$447.00
LY410572 Transient overexpression lysate of cell division cycle associated 3 (CDCA3) (as WB positive control) 100 ug
$436.00

Other products for "CDCA3 or NM_031299"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200821
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC200821 protein sequence
Red=Cloning site Green=Tags(s)

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT
LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN
QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP
GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112589
RefSeq Size 1944
RefSeq ORF 804
Synonyms GRCC8; TOME-1
Locus ID 83461
UniProt ID Q99618
Cytogenetics 12p13.31
Summary F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDCA3" proteins (3)
SKU Description Size Price
LC410572 Lyophilized CDCA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410572 Transient overexpression lysate of cell division cycle associated 3 (CDCA3) (as WB positive control) 100 ug
$436.00
TP300821 Recombinant protein of human cell division cycle associated 3 (CDCA3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products