OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAMAC (NM_031452) Human Mass Spec Standard

Be the first to review this product
SKU
PH300815
FAM103A1 MS Standard C13 and N15-labeled recombinant protein (NP_113640)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410524 Transient overexpression lysate of family with sequence similarity 103, member A1 (FAM103A1) (as WB positive control) 100 ug
$436.00

Other products for "RAMAC or NM_031452"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200815
Predicted MW 14.4 kDa
Protein Sequence
Protein Sequence
>RC200815 protein sequence
Red=Cloning site Green=Tags(s)

MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNR
WGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_113640
RefSeq Size 1588
RefSeq ORF 354
Synonyms C15orf18; FAM103A1; HsT19360; RAM; RAMMET
Locus ID 83640
UniProt ID Q9BTL3
Cytogenetics 15q25.2
Summary Regulatory subunit of the mRNA-capping methyltransferase RNMT:RAMAC complex that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs (PubMed:22099306, PubMed:27422871). Promotes the recruitment of the methyl donor, S-adenosyl-L-methionine, to RNMT (PubMed:27422871). Regulates RNMT expression by a post-transcriptional stabilizing mechanism (PubMed:22099306). Binds RNA (PubMed:22099306).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAMAC" proteins (3)
SKU Description Size Price
LC410524 Lyophilized FAM103A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410524 Transient overexpression lysate of family with sequence similarity 103, member A1 (FAM103A1) (as WB positive control) 100 ug
$436.00
TP300815 Recombinant protein of human family with sequence similarity 103, member A1 (FAM103A1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products