OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPSB2 (NM_032641) Human Mass Spec Standard

Be the first to review this product
SKU
PH300801
SPSB2 MS Standard C13 and N15-labeled recombinant protein (NP_116030)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343000 Rabbit Polyclonal Anti-SPSB2 Antibody
100 ul
$585.00
LY409988 Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SPSB2 or NM_032641"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200801
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC200801 protein sequence
Red=Cloning site Green=Tags(s)

MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP
VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL
YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC
QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116030
RefSeq Size 1272
RefSeq ORF 789
Synonyms GRCC9; SSB2
Locus ID 84727
UniProt ID Q99619
Cytogenetics 12p13.31
Summary This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2016
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPSB2" proteins (5)
SKU Description Size Price
LC409988 Lyophilized SPSB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431815 Lyophilized SPSB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409988 Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431815 Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300801 Recombinant protein of human splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products