OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFCAB11 (NM_145231) Human Mass Spec Standard

Be the first to review this product
SKU
PH300791
C14orf143 MS Standard C13 and N15-labeled recombinant protein (NP_660274)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407968 Transient overexpression lysate of chromosome 14 open reading frame 143 (C14orf143) (as WB positive control) 100 ug
$436.00

Other products for "EFCAB11 or NM_145231"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200791
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC200791 protein sequence
Red=Cloning site Green=Tags(s)

MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPN
TSGILLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVD
RDSDGHVSFRDFEYALNYGQKEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660274
RefSeq Size 2868
RefSeq ORF 489
Synonyms C14orf143
Locus ID 90141
UniProt ID Q9BUY7
Cytogenetics 14q32.11
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFCAB11" proteins (3)
SKU Description Size Price
LC407968 Lyophilized EFCAB11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407968 Transient overexpression lysate of chromosome 14 open reading frame 143 (C14orf143) (as WB positive control) 100 ug
$436.00
TP300791 Recombinant protein of human chromosome 14 open reading frame 143 (C14orf143), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products