CUEDC2 (NM_024040) Human Mass Spec Standard

CAT#: PH300790

CUEDC2 MS Standard C13 and N15-labeled recombinant protein (NP_076945)

Product Images

Coomassie blue staining of purified CUEDC2 protein (Cat# TP300790). The protein was produced from HEK293T cells transfected with CUEDC2 cDNA clone (Cat# RC200790) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200790
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200790 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAH
  IPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATG
  AEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKD
  ELKSFILQKYMMVDSA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076945
• RefSeq Size: 1203
• RefSeq ORF: 678
• Synonyms: bA18I14.5; C10orf66
• Locus ID: 79004
• UniProt ID: Q9H467
• Cytogenetics: 10q24.32
• Summary: Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.[UniProtKB/Swiss-Prot Function]