OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPDPF (NM_024299) Human Mass Spec Standard

Be the first to review this product
SKU
PH300783
PPDPF MS Standard C13 and N15-labeled recombinant protein (NP_077275)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411320 Transient overexpression lysate of pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) (PPDPF) (as WB positive control) 100 ug
$436.00

Other products for "PPDPF or NM_024299"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200783
Predicted MW 11.8 kDa
Protein Sequence
Protein Sequence
>RC200783 protein sequence
Red=Cloning site Green=Tags(s)

MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMAT
VLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077275
RefSeq Size 794
RefSeq ORF 342
Synonyms C20orf149; dJ697K14.9; exdpf
Locus ID 79144
UniProt ID Q9H3Y8
Cytogenetics 20q13.33
Summary Probable regulator of exocrine pancreas development.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPDPF" proteins (3)
SKU Description Size Price
LC411320 Lyophilized PPDPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411320 Transient overexpression lysate of pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) (PPDPF) (as WB positive control) 100 ug
$436.00
TP300783 Recombinant protein of human chromosome 20 open reading frame 149 (C20orf149), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products