CD52 (NM_001803) Human Mass Spec Standard

CAT#: PH300493

CD52 MS Standard C13 and N15-labeled recombinant protein (NP_001794)

Product Images

Coomassie blue staining of purified CD52 protein (Cat# TP300493). The protein was produced from HEK293T cells transfected with CD52 cDNA clone (Cat# RC200493) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200493
• Predicted MW: 6.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200493 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001794
• RefSeq Size: 523
• RefSeq ORF: 183
• Synonyms: CDW52; EDDM5; HE5
• Locus ID: 1043
• UniProt ID: P31358, V9HWN9
• Cytogenetics: 1p36.11
• Summary: May play a role in carrying and orienting carbohydrate, as well as having a more specific role.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane