OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GMDS (NM_001500) Human Mass Spec Standard

Be the first to review this product
SKU
PH300471
GMDS MS Standard C13 and N15-labeled recombinant protein (NP_001491)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502141 GMDS mouse monoclonal antibody, clone OTI2A1 (formerly 2A1) 100 ul
$447.00
LY419903 Transient overexpression lysate of GDP-mannose 4,6-dehydratase (GMDS) (as WB positive control) 100 ug
$436.00

Other products for "GMDS or NM_001500"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200471
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC200471 protein sequence
Red=Cloning site Green=Tags(s)

MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYK
NPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVK
TCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHE
SPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHS
VREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVA
FDELVREMVHADVELMRTNPNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001491
RefSeq Size 1700
RefSeq ORF 1116
Synonyms GMD; SDR3E1
Locus ID 2762
UniProt ID O60547
Cytogenetics 6p25.3
Summary GDP-mannose 4,6-dehydratase (GMD; EC 4.2.1.47) catalyzes the conversion of GDP-mannose to GDP-4-keto-6-deoxymannose, the first step in the synthesis of GDP-fucose from GDP-mannose, using NADP+ as a cofactor. The second and third steps of the pathway are catalyzed by a single enzyme, GDP-keto-6-deoxymannose 3,5-epimerase, 4-reductase, designated FX in humans (MIM 137020).supplied by OMIM, Aug 2009
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GMDS" proteins (3)
SKU Description Size Price
LC419903 Lyophilized GMDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419903 Transient overexpression lysate of GDP-mannose 4,6-dehydratase (GMDS) (as WB positive control) 100 ug
$436.00
TP300471 Recombinant protein of human GDP-mannose 4,6-dehydratase (GMDS), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products