OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIPR1 (NM_003310) Human Mass Spec Standard

Be the first to review this product
SKU
PH300409
TSSC1 MS Standard C13 and N15-labeled recombinant protein (NP_003301)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350549 Rabbit Polyclonal Anti-TSSC1 Antibody
100 ul
$205.00
LY418772 Transient overexpression lysate of tumor suppressing subtransferable candidate 1 (TSSC1) (as WB positive control) 100 ug
$436.00

Other products for "EIPR1 or NM_003310"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200409
Predicted MW 43.6 kDa
Protein Sequence
Protein Sequence
>RC200409 protein sequence
Red=Cloning site Green=Tags(s)

MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHI
SASPADRGVLTTCYNRTSDSKVLTCAAVWRMPKELESGSHESPDDSSSTAQTLELLCHLDNTAHGNMACV
VWEPMGDGKKIISLADNHILLWDLQESSSQAVLASSASLEGKGQLKFTSGRWSPHHNCTQVATANDTTLR
GWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWNVRY
NHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSV
YAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003301
RefSeq Size 1732
RefSeq ORF 1161
Synonyms EIPR-1; TSSC1
Locus ID 7260
UniProt ID Q53HC9
Cytogenetics 2p25.3
Summary This gene has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11. provided by RefSeq, Dec 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIPR1" proteins (3)
SKU Description Size Price
LC418772 Lyophilized TSSC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418772 Transient overexpression lysate of tumor suppressing subtransferable candidate 1 (TSSC1) (as WB positive control) 100 ug
$436.00
TP300409 Recombinant protein of human tumor suppressing subtransferable candidate 1 (TSSC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products