OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DARS1 (NM_001349) Human Mass Spec Standard

Be the first to review this product
SKU
PH300391
DARS MS Standard C13 and N15-labeled recombinant protein (NP_001340)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375324 DARS Rabbit polyclonal Antibody
100 ul
$410.00
LY419995 Transient overexpression lysate of aspartyl-tRNA synthetase (DARS) (as WB positive control) 100 ug
$436.00

Other products for "DARS1 or NM_001349"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200391
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC200391 representing NM_001349
Red=Cloning site Green=Tags(s)

MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSR
AKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQ
KIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETL
INKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH
RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCE
ALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTS
MFPRDPKRLTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001340
RefSeq Size 2322
RefSeq ORF 1503
Synonyms aspRS; DARS; HBSL
Locus ID 1615
UniProt ID P14868
Cytogenetics 2q21.3
Summary This gene encodes a member of a multienzyme complex that functions in mediating the attachment of amino acids to their cognate tRNAs. The encoded protein ligates L-aspartate to tRNA(Asp). Mutations in this gene have been found in patients showing hypomyelination with brainstem and spinal cord involvement and leg spasticity. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jun 2014
Protein Pathways Aminoacyl-tRNA biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DARS1" proteins (3)
SKU Description Size Price
LC419995 Lyophilized DARS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419995 Transient overexpression lysate of aspartyl-tRNA synthetase (DARS) (as WB positive control) 100 ug
$436.00
TP300391 Recombinant protein of human aspartyl-tRNA synthetase (DARS), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products