OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERH (NM_004450) Human Mass Spec Standard

Be the first to review this product
SKU
PH300367
ERH MS Standard C13 and N15-labeled recombinant protein (NP_004441)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA307978 Rabbit Polyclonal antibody to ERH (enhancer of rudimentary homolog (Drosophila))
100 ul
$665.00
LY417977 Transient overexpression lysate of enhancer of rudimentary homolog (Drosophila) (ERH) (as WB positive control) 100 ug
$436.00

Other products for "ERH or NM_004450"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200367
Predicted MW 12.3 kDa
Protein Sequence
Protein Sequence
>RC200367 protein sequence
Red=Cloning site Green=Tags(s)

MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL
VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004441
RefSeq Size 801
RefSeq ORF 312
Synonyms DROER
Locus ID 2079
UniProt ID P84090
Cytogenetics 14q24.1
Summary May have a role in the cell cycle.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERH" proteins (3)
SKU Description Size Price
LC417977 Lyophilized ERH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417977 Transient overexpression lysate of enhancer of rudimentary homolog (Drosophila) (ERH) (as WB positive control) 100 ug
$436.00
TP300367 Recombinant protein of human enhancer of rudimentary homolog (Drosophila) (ERH), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products