OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FCGRT (NM_004107) Human Mass Spec Standard

Be the first to review this product
SKU
PH300364
FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401327 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "FCGRT or NM_004107"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200364
Predicted MW 39.6 kDa
Protein Sequence
Protein Sequence
>RC200364 representing NM_004107
Red=Cloning site Green=Tags(s)

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA
QDADLKDVNVIPATA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004098
RefSeq Size 1510
RefSeq ORF 1095
Synonyms alpha-chain; FCRN
Locus ID 2217
UniProt ID P55899
Cytogenetics 19q13.33
Summary This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Apr 2009
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FCGRT" proteins (8)
SKU Description Size Price
PH327329 FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) 10 ug
$3,360.00
LC401327 Lyophilized FCGRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427768 Lyophilized FCGRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401327 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427768 Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300364 Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg 20 ug
$737.00
TP327329 Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2, 20 µg 20 ug
$737.00
TP721216 Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products