OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DGCR6L (NM_033257) Human Mass Spec Standard

Be the first to review this product
SKU
PH300317
DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370520 DGCR6L rabbit polyclonal antibody
100 ul
$310.00
LY409631 Transient overexpression lysate of DiGeorge syndrome critical region gene 6-like (DGCR6L) (as WB positive control) 100 ug
$436.00

Other products for "DGCR6L or NM_033257"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200317
Predicted MW 24.9 kDa
Protein Sequence
Protein Sequence
>RC200317 protein sequence
Red=Cloning site Green=Tags(s)

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK
IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ
CDQKGSPVPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150282
RefSeq Size 1217
RefSeq ORF 660
Synonyms DGCR6
Locus ID 85359
UniProt ID Q9BY27
Cytogenetics 22q11.21
Summary This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DGCR6L" proteins (3)
SKU Description Size Price
LC409631 Lyophilized DGCR6L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409631 Transient overexpression lysate of DiGeorge syndrome critical region gene 6-like (DGCR6L) (as WB positive control) 100 ug
$436.00
TP300317 Recombinant protein of human DiGeorge syndrome critical region gene 6-like (DGCR6L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products