PDCD10 (NM_007217) Human Mass Spec Standard
CAT#: PH300235
PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200235 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC200235 protein sequence
Red=Cloning site Green=Tags(s) MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT VA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009148 |
RefSeq Size | 1454 |
RefSeq ORF | 636 |
Synonyms | CCM3; TFAR15 |
Locus ID | 11235 |
UniProt ID | Q9BUL8 |
Cytogenetics | 3q26.1 |
Summary | This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407854 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407855 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416120 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407854 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 2 |
USD 436.00 |
|
LY407855 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 3 |
USD 436.00 |
|
LY416120 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 1 |
USD 436.00 |
|
TP300235 | Recombinant protein of human programmed cell death 10 (PDCD10), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720886 | Purified recombinant protein of Human programmed cell death 10 (PDCD10), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review