OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMCO1 (NM_019026) Human Mass Spec Standard

Be the first to review this product
SKU
PH300219
TMCO1 MS Standard C13 and N15-labeled recombinant protein (NP_061899)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331078 Rabbit polyclonal Anti-TMCO1 Antibody
100 ul
$585.00
LY402729 Transient overexpression lysate of transmembrane and coiled-coil domains 1 (TMCO1) (as WB positive control) 100 ug
$436.00

Other products for "TMCO1 or NM_019026"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200219
Predicted MW 21.2 kDa
Protein Sequence
Protein Sequence
>RC200219 protein sequence
Red=Cloning site Green=Tags(s)

MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIE
RQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTD
CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061899
RefSeq Size 4478
RefSeq ORF 564
Synonyms HP10122; PCIA3; PNAS-136; TMCC4
Locus ID 54499
UniProt ID Q9UM00
Cytogenetics 1q24.1
Summary This locus encodes a transmembrane protein. Mutations at this locus have been associated with craniofacial dysmorphism, skeletal anomalies, and cognitive disability. Mutations at this locus have also been associated with open angle glaucoma blindness. Alternatively spliced transcript variants have been described. provided by RefSeq, Jan 2012
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMCO1" proteins (3)
SKU Description Size Price
LC402729 Lyophilized TMCO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402729 Transient overexpression lysate of transmembrane and coiled-coil domains 1 (TMCO1) (as WB positive control) 100 ug
$436.00
TP300219 Recombinant protein of human transmembrane and coiled-coil domains 1 (TMCO1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products