TMCO1 Rabbit Polyclonal Antibody

SKU TA331078

Rabbit polyclonal Anti-TMCO1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMCO1 antibody: synthetic peptide directed towards the C terminal of human TMCO1. Synthetic peptide located within the following region: CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: transmembrane and coiled-coil domains 1
• Database Link:
  NP_061899
  Q9UM00
• Background: TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.
• Synonyms: HP10122; PCIA3; PNAS-136; TMCC4
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane