OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP23 (NM_017823) Human Mass Spec Standard

Be the first to review this product
SKU
PH300171
DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503944 DUSP23 mouse monoclonal antibody, clone OTI3C10 (formerly 3C10) 100 ul
$447.00
LY402621 Transient overexpression lysate of dual specificity phosphatase 23 (DUSP23) (as WB positive control) 100 ug
$436.00

Other products for "DUSP23 or NM_017823"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200171
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC200171 protein sequence
Red=Cloning site Green=Tags(s)

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA
PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK
AVFQFYQRTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060293
RefSeq Size 718
RefSeq ORF 450
Synonyms DUSP25; LDP-3; LDP3; MOSP; VHZ
Locus ID 54935
UniProt ID Q9BVJ7
Cytogenetics 1q23.2
Summary Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP23" proteins (3)
SKU Description Size Price
LC402621 Lyophilized DUSP23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402621 Transient overexpression lysate of dual specificity phosphatase 23 (DUSP23) (as WB positive control) 100 ug
$436.00
TP300171 Recombinant protein of human dual specificity phosphatase 23 (DUSP23), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products