OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ITGB3BP (NM_014288) Human Mass Spec Standard

Be the first to review this product
SKU
PH300064
ITGB3BP MS Standard C13 and N15-labeled recombinant protein (NP_055103)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803458 ITGB3BP mouse monoclonal antibody, clone OTI4H1 (formerly 4H1) 100 ul
$447.00
LY402304 Transient overexpression lysate of integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP) (as WB positive control) 100 ug
$436.00

Other products for "ITGB3BP or NM_014288"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200064
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC200064 protein sequence
Red=Cloning site Green=Tags(s)

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP
SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055103
RefSeq Size 1019
RefSeq ORF 531
Synonyms CENP-R; CENPR; HSU37139; NRIF3; TAP20
Locus ID 23421
UniProt ID Q13352
Cytogenetics 1p31.3
Summary This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ITGB3BP" proteins (3)
SKU Description Size Price
LC402304 Lyophilized ITGB3BP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402304 Transient overexpression lysate of integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP) (as WB positive control) 100 ug
$436.00
TP300064 Recombinant protein of human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products