ITGB3BP (NM_014288) Human Tagged ORF Clone

SKU
RC200064
ITGB3BP (Myc-DDK-tagged)-Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ITGB3BP
Synonyms CENP-R; CENPR; HSU37139; NRIF3; TAP20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200064 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGTTAAAAGATCACTGAAGTTGGATGGTCTGTTAGAAGAAAATTCATTTGATCCTTCAAAAATCA
CAAGGAAGAAAAGTGTTATAACTTATTCTCCAACAACTGGAACTTGTCAAATGAGTCTATTTGCTTCTCC
CACAAGTTCTGAAGAGCAAAAGCACAGAAATGGACTATCAAATGAAAAGAGAAAAAAATTGAATCACCCC
AGTTTAACTGAAAGCAAAGAATCTACAACAAAAGACAATGATGAATTCATGATGTTGCTATCAAAAGTTG
AGAAATTGTCAGAAGAAATCATGGAGATAATGCAAAATTTAAGTAGTATACAGGCTTTGGAGGGCAGTAG
AGAGCTTGAAAATCTCATTGGAATCTCCTGTGCATCACATTTCTTAAAAAGAGAAATGCAGAAAACCAAA
GAACTAATGACAAAAGTGAATAAACAAAAACTGTTTGAAAAGAGTACAGGACTTCCTCACAAAGCATCAC
GTCATCTTGACAGCTATGAATTCCTTAAAGCCATTTTAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200064 protein sequence
Red=Cloning site Green=Tags(s)

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP
SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014288
ORF Size 531 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014288.5
RefSeq Size 1019 bp
RefSeq ORF 534 bp
Locus ID 23421
UniProt ID Q13352
Cytogenetics 1p31.3
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
MW 20.2 kDa
Summary This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
Write Your Own Review
You're reviewing:ITGB3BP (NM_014288) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200064L1 Lenti ORF clone of Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200064L2 Lenti ORF clone of Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2, mGFP tagged 10 ug
$600.00
RC200064L3 Lenti ORF clone of Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200064L4 Lenti ORF clone of Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200064 ITGB3BP (tGFP-tagged) - Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320275 ITGB3BP (untagged)-Human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.