OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LMCD1 (NM_014583) Human Mass Spec Standard

Be the first to review this product
SKU
PH300062
LMCD1 MS Standard C13 and N15-labeled recombinant protein (NP_055398)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503139 LMCD1 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5) 100 ul
$447.00
LY402349 Transient overexpression lysate of LIM and cysteine-rich domains 1 (LMCD1) (as WB positive control) 100 ug
$436.00

Other products for "LMCD1 or NM_014583"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200062
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC200062 protein sequence
Red=Cloning site Green=Tags(s)

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG
RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE
KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE
EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE
PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT
KGQLLCPTCSKSKRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055398
RefSeq Size 1757
RefSeq ORF 1095
Locus ID 29995
UniProt ID Q9NZU5
Cytogenetics 3p25.3
Summary This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions. The protein may act as a co-regulator of transcription along with other transcription factors. Alternate splicing results in multiple transcript variants of this gene. provided by RefSeq, May 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LMCD1" proteins (4)
SKU Description Size Price
LC402349 Lyophilized LMCD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402349 Transient overexpression lysate of LIM and cysteine-rich domains 1 (LMCD1) (as WB positive control) 100 ug
$436.00
TP300062 Recombinant protein of human LIM and cysteine-rich domains 1 (LMCD1), 20 µg 20 ug
$737.00
TP721018 Purified recombinant protein of Human LIM and cysteine-rich domains 1 (LMCD1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products