OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLRB1 (NM_014183) Human Mass Spec Standard

Be the first to review this product
SKU
PH300051
DYNLRB1 MS Standard C13 and N15-labeled recombinant protein (NP_054902)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366581 DYNLRB1 rabbit polyclonal antibody
100 ul
$310.00
LY402287 Transient overexpression lysate of dynein, light chain, roadblock-type 1 (DYNLRB1) (as WB positive control) 100 ug
$436.00

Other products for "DYNLRB1 or NM_014183"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200051
Predicted MW 10.9 kDa
Protein Sequence
Protein Sequence
>RC200051 protein sequence
Red=Cloning site Green=Tags(s)

MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR
IRSKKNEIMVAPDKDYFLIVIQNPTE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054902
RefSeq Size 717
RefSeq ORF 288
Synonyms BITH; BLP; DNCL2A; DNLC2A; ROBLD1
Locus ID 83658
UniProt ID Q9NP97
Cytogenetics 20q11.22
Summary This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. provided by RefSeq, Aug 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNLRB1" proteins (3)
SKU Description Size Price
LC402287 Lyophilized DYNLRB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402287 Transient overexpression lysate of dynein, light chain, roadblock-type 1 (DYNLRB1) (as WB positive control) 100 ug
$436.00
TP300051 Recombinant protein of human dynein, light chain, roadblock-type 1 (DYNLRB1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products