OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SFT2D1 (NM_145169) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG204070
SFT2D1 (tGFP-tagged) - Human SFT2 domain containing 1 (SFT2D1)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "SFT2D1 or NM_145169"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SFT2D1
Synonyms C6orf83; pRGR1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204070 representing NM_145169
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAAGCTGCGGCGAGTCCTGAGCGGCCAGGACGACGAGGAGCAGGGCCTGACTGCGCAGGTCCTGG
ATGCCTCATCCCTTAGTTTCAACACCAGATTGAAATGGTTTGCCATCTGCTTCGTATGTGGCGTTTTCTT
TTCTATTCTTGGAACTGGATTGCTGTGGCTTCCGGGCGGCATAAAGCTTTTTGCAGTGTTTTATACCCTC
GGCAATCTTGCTGCGTTAGCCAGTACATGCTTTTTAATGGGACCTGTGAAGCAACTGAAGAAAATGTTTG
AAGCAACAAGATTGCTTGCAACAATTGTTATGCTTTTGTGTTTCATATTTACCCTGTGTGCTGCTCTTTG
GTGGCATAAGAAGGGACTGGCTGTGTTATTCTGCATATTGCAGTTCTTGTCAATGACCTGGTATAGCCTG
TCATACATCCCATATGCAAGGGATGCAGTTATTAAATGCTGTTCTTCTCTCCTAAGT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204070 representing NM_145169
Red=Cloning site Green=Tags(s)

MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTL
GNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSL
SYIPYARDAVIKCCSSLLS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_145169
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145169.1, NP_660152.1
RefSeq Size 717 bp
RefSeq ORF 480 bp
Locus ID 113402
UniProt ID Q8WV19
Cytogenetics 6q27
Protein Families Transmembrane
Summary May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_145169" in other vectors (4)
SKU Description Size Price
RC204070 SFT2D1 (Myc-DDK-tagged)-Human SFT2 domain containing 1 (SFT2D1) 10 ug
$150.00
RC204070L3 Lenti-ORF clone of SFT2D1 (Myc-DDK-tagged)-Human SFT2 domain containing 1 (SFT2D1) 10 ug
$450.00
RC204070L4 Lenti-ORF clone of SFT2D1 (mGFP-tagged)-Human SFT2 domain containing 1 (SFT2D1) 10 ug
$450.00
SC100096 SFT2D1 (untagged)-Human SFT2 domain containing 1 (SFT2D1) 10 ug
$150.00

Plasmid Map for RG204070

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG204070
Circular map for RG204070

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products