OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEC61B (NM_006808) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200247
SEC61B (tGFP-tagged) - Human Sec61 beta subunit (SEC61B)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA381334 SEC61B Rabbit polyclonal Antibody
100 ul
$475.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "SEC61B or NM_006808"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SEC61B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200247 representing NM_006808
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGTCCGACCCCCAGTGGCACTAACGTGGGATCCTCAGGGCGCTCTCCCAGCAAAGCAGTGGCCG
CCCGGGCGGCGGGATCCACTGTCCGGCAGAGGAAAAATGCCAGCTGTGGGACAAGGAGTGCAGGCCGCAC
AACCTCGGCAGGCACCGGGGGGATGTGGCGATTCTACACAGAAGATTCACCTGGGCTCAAAGTTGGCCCT
GTTCCAGTATTGGTTATGAGTCTTCTGTTCATCGCTTCTGTATTTATGTTGCACATTTGGGGCAAGTACA
CTCGTTCG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200247 representing NM_006808
Red=Cloning site Green=Tags(s)

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP
VPVLVMSLLFIASVFMLHIWGKYTRS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006808
ORF Size 288 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006808.3
RefSeq Size 583 bp
RefSeq ORF 291 bp
Locus ID 10952
UniProt ID P60468
Cytogenetics 9q22.33
Domains Sec61_beta
Protein Families Transmembrane
Protein Pathways Vibrio cholerae infection
Summary The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006808" in other vectors (6)
SKU Description Size Price
RC200247 SEC61B (Myc-DDK-tagged)-Human Sec61 beta subunit (SEC61B) 10 ug
$289.00
RC200247L1 Lenti ORF clone of Human Sec61 beta subunit (SEC61B), Myc-DDK-tagged 10 ug
$450.00
RC200247L2 Lenti ORF clone of Human Sec61 beta subunit (SEC61B), mGFP tagged 10 ug
$450.00
RC200247L3 Lenti ORF clone of Human Sec61 beta subunit (SEC61B), Myc-DDK-tagged 10 ug
$450.00
RC200247L4 Lenti ORF clone of Human Sec61 beta subunit (SEC61B), mGFP tagged 10 ug
$450.00
SC115862 SEC61B (untagged)-Human Sec61 beta subunit (SEC61B) 10 ug
$150.00

Plasmid Map for RG200247

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200247
Circular map for RG200247

file-alt Citations

Identification of SEC61B as a novel regulator of calcium flux and platelet hyperreactivity in diabetes mellitus
Kong, Rehan, Moreno et al
bioRxiv (2024)
Cited by 1
Snippet: The ORF for the Human SEC61B (NM_006808) was purchased from Origene (RG200247) and cloned using NEBuilder HiFi DNA Assembly (NEB #E2621) into a lentiviral backbone (Addgene, cat# 52961) for stable expression. The following primers were used to amplify the recipient vector 5’-atgaccgagtacaagcccac-3’ and 5’-GGTACCTTAATTAACCAAACTGGATC-3’. Two fragments were amplified and inserted
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products