OriGene Logo

Ccdc25 (NM_145944) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG217068
Ccdc25 (tGFP-tagged) - Mouse coiled-coil domain containing 25 (Ccdc25), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Ccdc25 or NM_145944"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ccdc25
Synonyms 2610528H13Rik; NSrp70
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG217068 representing NM_145944
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTTCTACTTCACCAGCAGCAGCGTTAATTCATCTACTTACACTATTTACATGGGAAAGGATAAAT
ATGAAAATGAAGATCTGATAAAGTATGGCTGGCCTGAAGATATTTGGTTTCACGTGGACAAACTCTCTTC
GGCCCATGTGTACCTACGATTACAAAAGGGAGAGAAGATAGAAGACATTCCAAAGGAGGTTTTGATGGAC
TGTGCCCACCTTGTGAAGGCCAATAGCATTCAAGGCTGCAAGATGAACAACGTTAATGTGGTTTACACGC
CATGGTCTAACCTGAAGAAAACAGCTGACATGGATGTGGGGCAGATAGGCTTTCACAGGCAGAAGGATGT
AAAGATTGTGACGGTAGAGAAGAAAGTGAATGAAATCTTGAACCGATTAGAAAAGACCAAACTGGAGAAG
TTTCCAGACCTTGCAGCAGAGAAGGAAGGCAGAGACCGTGAAGAGAGGAATGAGAAGAAAGCCCAGATTC
AGGAGATGAAAAGGAAAGAGAAAGAAGAAATGAAGAAGAAAAGGGAAATGGATGAACTTAGGAGCTACTC
ATCACTCATGAAAGTTGAGAATATGTCCTCAAATCAAGATGGTAACGATTCCGATGAGTTCATG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG217068 representing NM_145944
Red=Cloning site Green=Tags(s)

MVFYFTSSSVNSSTYTIYMGKDKYENEDLIKYGWPEDIWFHVDKLSSAHVYLRLQKGEKIEDIPKEVLMD
CAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKLEK
FPDLAAEKEGRDREERNEKKAQIQEMKRKEKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_145944
ORF Size 624 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145944.5
RefSeq Size 2228 bp
RefSeq ORF 627 bp
Locus ID 67179
UniProt ID Q78PG9
Cytogenetics 14 D1
Summary Transmembrane receptor that senses neutrophil extracellular traps (NETs) and triggers the ILK-PARVB pathway to enhance cell motility. NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation (By similarity). Formation of NETs is also associated with cancer metastasis, NET-DNA acting as a chemotactic factor to attract cancer cells (By similarity). Specifically binds NETs on its extracellular region, in particular the 8-OHdG-enriched DNA present in NETs, and recruits ILK, initiating the ILK-PARVB cascade to induce cytoskeleton rearrangement and directional migration of cells (By similarity). In the context of cancer, promotes cancer metastasis by sensing NETs and promoting migration of tumor cells (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_145944" in other vectors (4)
SKU Description Size Price
MC210501 Ccdc25 (untagged) - Mouse coiled-coil domain containing 25 (Ccdc25), (10ug) 10 ug
$330.00
MR217068 Ccdc25 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 25 (Ccdc25) 10 ug
$289.00 $300.00
MR217068L3 Lenti ORF clone of Ccdc25 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 25 (Ccdc25) 10 ug
$600.00
MR217068L4 Lenti ORF clone of Ccdc25 (mGFP-tagged) - Mouse coiled-coil domain containing 25 (Ccdc25) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.