OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Yipf6 (NM_207633) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202877
Yipf6 (tGFP-tagged) - Mouse Yip1 domain family, member 6 (Yipf6)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA389694 Yipf6 Rabbit pAb
100 ul
$410.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Yipf6 or NM_207633"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Yipf6
Synonyms A430107J06Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202877 representing NM_207633
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAAGCGGAGGACTCTCCGGGAGAACAGGAGGCAGCGGCATCCAAGCCCCTGTTTGCAGGGTTGT
CTGATGTGTCAATTTCTCAGGACATTCCCATAGAAGGGGAGATTACCATCCCCTCCAGAGCTCGTGCTCA
AGAACATGACAGCTCCACACTGAATGAATCCATTCGTCGGACCATTATGCGAGATCTAAAAGCTGTGGGA
AGGAAATTTATGCATGTTTTATATCCAAGGAAGAGTAATGCACTGTTAAGAGACTGGGACCTGTGGGGCC
CATTGATACTTTGTGTGACACTTGCATTGATGTTACAGAAAAGTTCCATTGATGGGAAGAATGATGGCGG
AGGCCCAGAATTCGCAGAAGTATTTGTTATCATCTGGTTTGGAGCAGTTACCATCACGCTGAATTCCAAA
CTTCTTGGCGGAAACATTTCTTTTTTTCAGAGTCTCTGTGTATTAGGGTACTGCATTCTTCCTTTGAACA
TCGCAATGCTGATCTGCCGCTTGCTGCTTTTGGCTGGACAGGGACCAATAAACTTCATGATTCGGCTTTT
TGTAGTGTTGTTGATGTTCGCTTGGTCCGTGGTGGCATCTACAGCATTCCTTGCTGACAGCCAGCCTCCA
AACAGAAAAGCCCTGGCAGTGTATCCTGTCTTTTTATTCTACTTTGTCATCAGTTGGATGATACTCACGT
TCACGCCA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202877 representing NM_207633
Red=Cloning site Green=Tags(s)

MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVG
RKFMHVLYPRKSNALLRDWDLWGPLILCVTLALMLQKSSIDGKNDGGGPEFAEVFVIIWFGAVTITLNSK
LLGGNISFFQSLCVLGYCILPLNIAMLICRLLLLAGQGPINFMIRLFVVLLMFAWSVVASTAFLADSQPP
NRKALAVYPVFLFYFVISWMILTFTP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_207633
ORF Size 708 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_207633.2, NP_997516.1
RefSeq Size 5195 bp
RefSeq ORF 711 bp
Locus ID 77929
UniProt ID Q8BR70
Cytogenetics X C3
Summary May be required for stable YIPF1 and YIPF2 protein expression.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_207633" in other vectors (4)
SKU Description Size Price
MC203363 Yipf6 (untagged) - Mouse Yip1 domain family, member 6 (Yipf6), (10ug) 10 ug
$300.00
MR202877 Yipf6 (Myc-DDK-tagged) - Mouse Yip1 domain family, member 6 (Yipf6) 10 ug
$289.00 $300.00
MR202877L3 Lenti ORF clone of Yipf6 (Myc-DDK-tagged) - Mouse Yip1 domain family, member 6 (Yipf6) 10 ug
$600.00
MR202877L4 Lenti ORF clone of Yipf6 (mGFP-tagged) - Mouse Yip1 domain family, member 6 (Yipf6) 10 ug
$600.00

Plasmid Map for MG202877

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG202877
Circular map for MG202877

file-alt Citations

Yip1 domain family, member 6 (Yipf6) mutation induces spontaneous intestinal inflammation in mice
Brandl, Tomisato, Li et al
PNAS (2012) 109 (31), 12650-5 DOI: 10.1073/pnas.1210366109
Cited by 40
AI Summary: OriGene’s Yipf6-GFP plasmid (MG202877) was used in this study to investigate the cellular localization and function of Yipf6, helping to elucidate its role in intestinal homeostasis and inflammation.
Snippet: cells. However, homeostatic mechanisms normally restore the status quo ante, so that dysfunction is short-lived. These ... ATTGGTCCCTGTCCAGCCAAAAG. Yipf6-GFP plasmid was purchased from Origene (MG202877). Kdel
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products