OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Efna2 (NM_007909) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202249
Efna2 (tGFP-tagged) - Mouse ephrin A2 (Efna2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Efna2 or NM_007909"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Efna2
Synonyms CEK7L; Elf1; Epl6; Eplg6; Lerk6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202249 representing NM_007909
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCGCGCAGCGCCCGCTGCTGCCGCTGCTGCTGCTGCTGCTGCCGCTGCGTGCGCGCAACGAGG
ACCCGGCCCGGGCCAACGCTGACCGATACGCAGTCTACTGGAACCGTAGCAACCCCAGGTTTCAGGTGAG
CGCTGTGGGTGATGGCGGCGGCTATACCGTGGAGGTGAGCATCAACGACTACCTGGATATCTACTGCCCA
CACTACGGGGCGCCGCTGCCCCCGGCTGAGCGCATGGAGCGGTACATCCTGTACATGGTGAATGGTGAGG
GCCACGCCTCCTGTGACCACCGGCAGCGAGGCTTCAAGCGCTGGGAATGCAACCGGCCCGCAGCGCCCGG
GGGACCCCTCAAGTTCTCAGAGAAGTTCCAACTCTTCACCCCCTTTTCCCTGGGCTTTGAGTTCCGGCCT
GGCCACGAATACTACTACATCTCTGCCACACCTCCCAACCTCGTGGACCGACCCTGCCTGCGACTCAAGG
TTTATGTGCGTCCAACCAATGAGACCCTGTATGAGGCTCCAGAGCCCATCTTCACCAGTAACAGCTCCTG
CAGCGGCCTGGGTGGCTGCCACCTCTTCCTCACCACCGTCCCTGTGCTGTGGTCCCTTCTGGGCTCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202249 representing NM_007909
Red=Cloning site Green=Tags(s)

MAPAQRPLLPLLLLLLPLRARNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCP
HYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRP
GHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSNSSCSGLGGCHLFLTTVPVLWSLLGS

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007909
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007909.3, NP_031935.3
RefSeq Size 2153 bp
RefSeq ORF 630 bp
Locus ID 13637
UniProt ID P52801
Cytogenetics 10 39.72 cM
Summary Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. With the EPHA2 receptor may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007909" in other vectors (4)
SKU Description Size Price
MC208422 Efna2 (untagged) - Mouse ephrin A2 (Efna2), (10ug) 10 ug
$330.00
MR202249 Efna2 (Myc-DDK-tagged) - Mouse ephrin A2 (Efna2) 10 ug
$289.00 $300.00
MR202249L3 Lenti ORF clone of Efna2 (Myc-DDK-tagged) - Mouse ephrin A2 (Efna2) 10 ug
$600.00
MR202249L4 Lenti ORF clone of Efna2 (mGFP-tagged) - Mouse ephrin A2 (Efna2) 10 ug
$600.00

Plasmid Map for MG202249

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG202249
Circular map for MG202249

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products